PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G012661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 241aa    MW: 27390.8 Da    PI: 7.3669
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G012661.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.1e-091964447
                          S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                          WT eEd+l+ +a   +  +   +W++Ia++++ g++  +++ +++++
  HL.SW.v1.0.G012661.1 19 WTREEDKLFEKALVDFAHDlpnRWDRIASRLP-GKSIPDVIRHYNDL 64
                          *********99997777777777*********.***********986 PP

2Myb_DNA-binding47.93.1e-15116160347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +WT+eE++l++++ k++G+g+W++I+r +  +Rt+ q+ s+ qky
  HL.SW.v1.0.G012661.1 116 PWTEEEHKLFLKGLKLFGKGDWRSISRNVVITRTPTQVASHAQKY 160
                           8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.0E-61567IPR001005SANT/Myb domain
SuperFamilySSF466892.48E-111773IPR009057Homeodomain-like
PROSITE profilePS500907.1661965IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.1E-51965IPR009057Homeodomain-like
CDDcd001673.66E-81965No hitNo description
PfamPF002491.2E-71964IPR001005SANT/Myb domain
PROSITE profilePS5129419.832109165IPR017930Myb domain
SuperFamilySSF466894.07E-17111166IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-17112163IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-11113159IPR009057Homeodomain-like
SMARTSM007175.2E-13113163IPR001005SANT/Myb domain
CDDcd001675.92E-11116161No hitNo description
PfamPF002491.0E-13116160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MFQEARDWNM ATQPYSTWWT REEDKLFEKA LVDFAHDLPN RWDRIASRLP GKSIPDVIRH  60
YNDLVHDVME IDSGRVALPS YTDCSAEGLN GWDSANQISF GSKAKQAEPE RKKGTPWTEE  120
EHKLFLKGLK LFGKGDWRSI SRNVVITRTP TQVASHAQKY FLRLESGPKE RKRSSIHDIT  180
TVDGISDSVP SDQMCLHPPP PPNQSQQFPT IQQLNSPPNH MTMATTHGGP MGYQHYGFQM  240
*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142868.15e-91hypothetical protein PHAVU_007G023600g
SwissprotQ8S9H71e-64DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV7BAF76e-91V7BAF7_PHAVU; Uncharacterized protein
STRINGGLYMA10G42450.19e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.18e-61MYB family protein